PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0222s0047.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 352aa    MW: 39048.5 Da    PI: 7.0635
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0222s0047.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.9e-32200254155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k r+rWt++LH++Fve+v++LGGs+kAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Kalax.0222s0047.1.p 200 KMRIRWTQDLHDKFVECVNRLGGSDKATPKAILKLMDSDGLTIFHVKSHLQKYRT 254
                          67****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.041197257IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-28198255IPR009057Homeodomain-like
SuperFamilySSF466891.59E-16198254IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23200255IPR006447Myb domain, plants
PfamPF002491.6E-8204253IPR001005SANT/Myb domain
PfamPF143798.5E-21281327IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MNSHDNNNGL ERIRLNHGLM SSGCSYDFVN SYSPSVSQSD PRWHSMGGGG SEIMHSQTLI  60
TPTKLPSTIL SRLGSPASAF YATERCMAGF PQSRLDQTPS FPLDSQFMNT LQSVVQPHLL  120
TANQYKSVFR NNPATSGNST LAPTVSIPFQ GIPDDKFCSS SSANTGLFSW SQTDGGNQYV  180
ETCSSHTTNR FSPGSTLSSK MRIRWTQDLH DKFVECVNRL GGSDKATPKA ILKLMDSDGL  240
TIFHVKSHLQ KYRTAKYLPE SAEGKDTRSE SVHLDMKTGL QIKEALQMQL DVQKTLHEQL  300
EIQRNLQLRI EEQGKQLRMM FDQHHKTNTS SSGHDDPTED NHPCEDTSVQ S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308371.23e-85myb family transcription factor family protein
TrEMBLB9HAD33e-85B9HAD3_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0006s20540.18e-85(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-67G2-like family protein